PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G65080.2
Common NameAGL68, MAF5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 197aa    MW: 22509.1 Da    PI: 10.2648
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G65080.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.53e-22956148
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                 krienks rqvtf+kRrng++ KA  LS+LC+  va+ i+sstgkly 
  AT5G65080.2  9 KRIENKSSRQVTFCKRRNGLMEKARQLSILCGSSVALFIVSSTGKLYN 56
                 79********************************************97 PP

2K-box40.89.4e-15801631298
        K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  ++ e  +q++   k+ +e  qr++   +G++    s++ L ++e+qL+++l+ iR++K+ell+e +++lq kek l+e+nk L +++
  AT5G65080.2  80 QDLEDKTQDYLSHKELLEIVQRKIEEAKGDN---VSIESLISMEEQLKSALSVIRARKTELLMELVKNLQDKEKLLKEKNKVLASEV 163
                  4567788999999999999**********86...69**********************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.698161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-31160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-23163IPR002100Transcription factor, MADS-box
PRINTSPR004049.4E-23323IPR002100Transcription factor, MADS-box
PfamPF003193.6E-211055IPR002100Transcription factor, MADS-box
PRINTSPR004049.4E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004049.4E-233859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.9579172IPR002487Transcription factor, K-box
PfamPF014862.0E-1093162IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009910Biological Processnegative regulation of flower development
GO:0010048Biological Processvernalization response
GO:0048587Biological Processregulation of short-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0004507developmental stageplant embryo bilateral stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MGRRRVEIKR IENKSSRQVT FCKRRNGLME KARQLSILCG SSVALFIVSS TGKLYNSSSG  60
DRVVYVSWKR KNFTIFLSWQ DLEDKTQDYL SHKELLEIVQ RKIEEAKGDN VSIESLISME  120
EQLKSALSVI RARKTELLME LVKNLQDKEK LLKEKNKVLA SEVGKLKKIL ETGDERAVMS  180
PENSSGHSPP ETLPLLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mnm_A2e-143591874PROTEIN (MCM1 TRANSCRIPTIONAL REGULATOR)
1mnm_B2e-143591874PROTEIN (MCM1 TRANSCRIPTIONAL REGULATOR)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.286870.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425687800.0
Genevisible247224_at0.0
Expression AtlasAT5G65080-
AtGenExpressAT5G65080-
ATTED-IIAT5G65080-
Functional Description ? help Back to Top
Source Description
TAIRIs upregulated during vernalization and regulates flowering time. Encodes MADS-domain protein. Two variants encoding proteins of 198 and 184 amino acids have been reported.
Function -- GeneRIF ? help Back to Top
  1. the repression of MAF5 by VIL2 provides a mechanism to promote flowering in noninductive photoperiods, which contributes to the facultative nature of the Arabidopsis photoperiodic response.
    [PMID: 20837520]
  2. MADS AFFECTING FLOWERING 4 (MAF4) and MAF5 are also upregulated in TEK knockdown plants.
    [PMID: 23733063]
  3. RING1A suppresses the expression of MAF4 and MAF5 through affecting H3K27me3 levels at these loci to regulate the floral transition
    [PMID: 24553292]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G65080.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G65080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1751800.0AK175180.1 Arabidopsis thaliana mRNA for MADS box protein FCL1, complete cds, clone: RAFL21-59-G18.
GenBankAY1412190.0AY141219.1 Arabidopsis thaliana MADS-box protein AGL68 mRNA, complete cds.
GenBankAY2314550.0AY231455.1 Arabidopsis thaliana MADS affecting flowering 5 variant I (MAF5) mRNA, complete cds.
GenBankBT0252680.0BT025268.1 Arabidopsis thaliana At5g65080 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001078799.11e-141protein MADS AFFECTING FLOWERING 5
SwissprotQ683D71e-114MAF5_ARATH; Protein MADS AFFECTING FLOWERING 5
TrEMBLC0J8J27e-99C0J8J2_ARATH; MAF5
STRINGAT5G65080.11e-111(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ratcliffe OJ,Kumimoto RW,Wong BJ,Riechmann JL
    Analysis of the Arabidopsis MADS AFFECTING FLOWERING gene family: MAF2 prevents vernalization by short periods of cold.
    Plant Cell, 2003. 15(5): p. 1159-69
    [PMID:12724541]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  6. Albert VA, et al.
    Floral gene resources from basal angiosperms for comparative genomics research.
    BMC Plant Biol., 2005. 5: p. 5
    [PMID:15799777]
  7. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  8. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  9. Czechowski T,Stitt M,Altmann T,Udvardi MK,Scheible WR
    Genome-wide identification and testing of superior reference genes for transcript normalization in Arabidopsis.
    Plant Physiol., 2005. 139(1): p. 5-17
    [PMID:16166256]
  10. Deal RB,Topp CN,McKinney EC,Meagher RB
    Repression of flowering in Arabidopsis requires activation of FLOWERING LOCUS C expression by the histone variant H2A.Z.
    Plant Cell, 2007. 19(1): p. 74-83
    [PMID:17220196]
  11. Bieniawska Z, et al.
    Analysis of the sucrose synthase gene family in Arabidopsis.
    Plant J., 2007. 49(5): p. 810-28
    [PMID:17257168]
  12. Bieniawska Z, et al.
    Disruption of the Arabidopsis circadian clock is responsible for extensive variation in the cold-responsive transcriptome.
    Plant Physiol., 2008. 147(1): p. 263-79
    [PMID:18375597]
  13. Falkenberg B, et al.
    Transcription factors relevant to auxin signalling coordinate broad-spectrum metabolic shifts including sulphur metabolism.
    J. Exp. Bot., 2008. 59(10): p. 2831-46
    [PMID:18596113]
  14. Li WX, et al.
    The Arabidopsis NFYA5 transcription factor is regulated transcriptionally and posttranscriptionally to promote drought resistance.
    Plant Cell, 2008. 20(8): p. 2238-51
    [PMID:18682547]
  15. Xu L, et al.
    The E2 ubiquitin-conjugating enzymes, AtUBC1 and AtUBC2, play redundant roles and are involved in activation of FLC expression and repression of flowering in Arabidopsis thaliana.
    Plant J., 2009. 57(2): p. 279-88
    [PMID:18798874]
  16. Cao Y,Dai Y,Cui S,Ma L
    Histone H2B monoubiquitination in the chromatin of FLOWERING LOCUS C regulates flowering time in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2586-602
    [PMID:18849490]
  17. Jiang D,Wang Y,Wang Y,He Y
    Repression of FLOWERING LOCUS C and FLOWERING LOCUS T by the Arabidopsis Polycomb repressive complex 2 components.
    PLoS ONE, 2008. 3(10): p. e3404
    [PMID:18852898]
  18. Caicedo AL,Richards C,Ehrenreich IM,Purugganan MD
    Complex rearrangements lead to novel chimeric gene fusion polymorphisms at the Arabidopsis thaliana MAF2-5 flowering time gene cluster.
    Mol. Biol. Evol., 2009. 26(3): p. 699-711
    [PMID:19139056]
  19. Kim DH,Sung S
    The Plant Homeo Domain finger protein, VIN3-LIKE 2, is necessary for photoperiod-mediated epigenetic regulation of the floral repressor, MAF5.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(39): p. 17029-34
    [PMID:20837520]
  20. Kim DH,Sung S
    Role of VIN3-LIKE 2 in facultative photoperiodic flowering response in Arabidopsis.
    Plant Signal Behav, 2010. 5(12): p. 1672-3
    [PMID:21150261]
  21. Yoo SK,Wu X,Lee JS,Ahn JH
    AGAMOUS-LIKE 6 is a floral promoter that negatively regulates the FLC/MAF clade genes and positively regulates FT in Arabidopsis.
    Plant J., 2011. 65(1): p. 62-76
    [PMID:21175890]
  22. Yu CW, et al.
    HISTONE DEACETYLASE6 interacts with FLOWERING LOCUS D and regulates flowering in Arabidopsis.
    Plant Physiol., 2011. 156(1): p. 173-84
    [PMID:21398257]
  23. Yun JY,Tamada Y,Kang YE,Amasino RM
    Arabidopsis trithorax-related3/SET domain GROUP2 is required for the winter-annual habit of Arabidopsis thaliana.
    Plant Cell Physiol., 2012. 53(5): p. 834-46
    [PMID:22378382]
  24. Shen L, et al.
    The putative PRC1 RING-finger protein AtRING1A regulates flowering through repressing MADS AFFECTING FLOWERING genes in Arabidopsis.
    Development, 2014. 141(6): p. 1303-12
    [PMID:24553292]